Transcription Factor
| Accessions: | 5k5l_F (3D-footprint 20231221) |
| Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P49711 |
| Length: | 57 |
| Pfam Domains: | 2-25 C2H2-type zinc finger 2-25 Zinc finger, C2H2 type 33-54 C2H2-type zinc finger 33-54 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 KFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNE |
| Interface Residues: | 12, 13, 14, 15, 16, 19, 20, 22, 24, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55 |
| 3D-footprint Homologues: | 3uk3_C, 2kmk_A, 8gn3_A, 6ml4_A, 5ei9_F, 1g2f_F, 7w1m_H, 5und_A, 8h9h_G, 6u9q_A, 5k5i_A, 1mey_C, 5v3j_F, 8ssq_A, 7eyi_G, 5k5l_F, 5yel_A, 4x9j_A, 1f2i_J, 8ssu_A, 7n5w_A, 5kkq_D, 4m9v_C, 2i13_A, 8gh6_A, 7y3m_I |
| Binding Motifs: | 5k5l_F gCGg |
| Binding Sites: | 5k5l_C 5k5l_D |
| Publications: | Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.