Transcription Factor
Accessions: | FOXJ2_TF1 (HumanTF2 1.0), FOXJ2 (HT-SELEX2 May2017) |
Names: | Fork head homologous X, Forkhead box protein J2, FOXJ2, FOXJ2_HUMAN, ENSG00000065970 |
Organisms: | Homo sapiens |
Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q9P0K8 |
Notes: | Ensembl ID: ENSG00000065970; Construct type: TF1(SBP); TF family: Forkhead; Clone source: Jolma et al. 2013, TF family: Forkhead experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
Length: | 152 |
Pfam Domains: | 22-100 Fork head domain |
Sequence: (in bold interface residues) | 1 GSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYK 60 61 NAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDLSQDS 120 121 PEQEASKSPRGGVAGSGEASLPPEGNPQMSLQ |
Interface Residues: | 45, 64, 65, 67, 68, 69, 71, 72, 73, 75, 76, 79, 81, 82, 85, 92 |
3D-footprint Homologues: | 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7vou_C, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 2a07_J, 7yz7_A, 3g73_A, 7tdx_A, 2c6y_A, 7yzb_A, 6el8_A, 8sro_B, 2o4a_A |
Binding Motifs: | FOXJ2_ELF1_1 rtaaACmGGAAGwr FOXJ2_ELF1_2 rcAGAAAACCGAAwm FOXJ2_HOXB13_1 tTTwAykdgwmAACA FOXJ2_HOXB13_2 rtmaAcaymrTaAaa FOXJ2_HOXB13_2_3 rTAAACwwATWAAa FOXJ2_HOXB13_2_3_4 kTTwAykrymaACA FOXJ2_PITX1_1 yTAATCCcdamAAcA FOXJ2_PITX1_2 TAAAcaGGATTA FOXJ2_2 wtTRTTGTAAAyAa FOXJ2_methyl_1 wwTRTTGTAAAyAw |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.