Transcription Factor

						

			
Accessions: SOHLH2 (HT-SELEX2 May2017)

			
Names: ENSG00000120669, SOHLH2
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 118
Pfam Domains:     23-69 Helix-loop-helix DNA-binding domain
Sequence: 
(in bold interface residues)		   1 GNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVLE   60
  61 ATVDYVKYIREKISPAVMAQITEALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMST
Interface Residues: 23, 24, 26, 27, 30, 31, 55
3D-footprint Homologues: 7d8t_A, 5eyo_A, 7ssa_L, 4h10_A, 6g1l_A, 8osl_P, 4h10_B, 5nj8_C, 8osl_O
Binding Motifs: SOHLH2_2 ygCACGTGcr
SOHLH2_methyl_1 mgmACGTgca
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.