Transcription Factor

Accessions: GATA3_DBD (HumanTF 1.0)
Names: GATA-binding factor 3, GATA3, GATA3_HUMAN, Trans-acting T-cell-specific transcription factor GATA-3
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P23771
Notes: Ensembl ID: ENSG00000107485; DNA-binding domain sequence; TF family: GATA; Clone source: Megaman
Length: 146
Pfam Domains: 28-61 GATA zinc finger
82-114 GATA zinc finger
Sequence:
(in bold interface residues)
1 MASLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG 60
61 QNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLT 120
121 MKKEGIQTRNRKMSSKSKKCKKVHDS
Interface Residues: 37, 38, 40, 50, 54, 91, 92, 94, 104, 108, 109, 112, 128, 129, 131, 132
3D-footprint Homologues: 4hc9_A, 3vd6_C, 1gat_A, 3dfx_B, 4gat_A, 6cnb_R
Binding Motifs: GATA3_DBD aGATAasr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.