Transcription Factor
| Accessions: | ZIC5 (HT-SELEX2 May2017) |
| Names: | ENSG00000139800, ZIC5 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 155 |
| Pfam Domains: | 19-45 Zinc finger, C2H2 type 25-45 C2H2-type zinc finger 40-63 Zinc-finger double domain 51-75 C2H2-type zinc finger 51-75 Zinc finger, C2H2 type 67-94 Zinc-finger double domain 81-105 C2H2-type zinc finger 99-124 Zinc-finger double domain 111-135 C2H2-type zinc finger 111-135 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 LVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKPFPCPFPGCGK 60 61 VFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDK 120 121 SYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPV |
| Interface Residues: | 27, 29, 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 46, 63, 64, 65, 66, 67, 69, 70, 71, 72, 75, 76, 79, 93, 94, 95, 96, 97, 98, 99, 100, 101, 103, 104, 123, 124, 125, 126, 127, 129, 130 |
| 3D-footprint Homologues: | 7w1m_H, 1tf3_A, 8cuc_F, 5v3j_F, 7n5w_A, 4x9j_A, 5ei9_F, 2kmk_A, 8ssq_A, 2gli_A, 1g2f_F, 8ssu_A, 1tf6_A, 6ml4_A, 5kkq_D, 1ubd_C, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 5k5i_A, 2i13_A, 8gn3_A, 5und_A, 2jpa_A, 2lt7_A, 6jnm_A, 3uk3_C, 7y3l_A, 6u9q_A, 5yel_A, 1mey_C, 7txc_E, 5kl3_A, 2drp_D, 1f2i_J, 1llm_D, 6blw_A, 2v6e_B, 4m9v_C, 7y3m_I, 6a57_A, 2wbs_A, 5yj3_D |
| Binding Motifs: | ZIC5_2 mgACCCCCCGCtGyGm ZIC5_methyl_1 rgACCCCCyGCTGTGm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.