Transcription Factor

Accessions: 2hzv_A (3D-footprint 20260701), 2hzv_B (3D-footprint 20260701), 2hzv_C (3D-footprint 20260701), 2hzv_D (3D-footprint 20260701), 2hzv_E (3D-footprint 20260701), 2hzv_F (3D-footprint 20260701), 2hzv_G (3D-footprint 20260701), 2hzv_H (3D-footprint 20260701)
Names: Nickel-responsive regulator, NIKR_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A6Z6
Length: 131
Pfam Domains: 3-41 Ribbon-helix-helix protein, copG family
54-130 NikR C terminal nickel binding domain
Sequence:
(in bold interface residues)
1 MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVY 60
61 EHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRG 120
121 VRHGHLQCLPK
Interface Residues: 3, 5, 7, 10, 32, 53, 56, 65
3D-footprint Homologues: 1b01_B, 6mrj_D, 2hzv_A, 7nyw_J, 3gxq_A, 5xvp_B
Binding Motifs: 2hzv_A TCAta
2hzv_ABCD GTyTGAnnnnnnnnnnnnnnnnTCAwAC
2hzv_EFGH aGTATGAcnnnnnnnnnnnnnnnTCATAC
Binding Sites: 2hzv_I / 2hzv_K
2hzv_J / 2hzv_L
Publications: Schreiter E.R, Wang S.C, Zamble D.B, Drennan C.L. NikR-operator complex structure and the mechanism of repressor activation by metal ions. Proceedings of the National Academy of Sciences of the United States of America 103:13676-81 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.