Transcription Factor

Accessions: 1p47_B (3D-footprint 20231221)
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, Zinc finger protein Krox-24
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 84
Pfam Domains: 3-27 C2H2-type zinc finger
3-27 Zinc finger, C2H2 type
20-43 Zinc-finger double domain
33-55 Zinc finger, C2H2 type
33-55 C2H2-type zinc finger
47-71 Zinc-finger double domain
61-83 Zinc finger, C2H2 type
61-79 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60
61 FACDICGRKFARSDERKRHTKIHL
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 41, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79
3D-footprint Homologues: 1tf3_A, 6jnm_A, 7n5w_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5ei9_F, 2jpa_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 7eyi_G, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 2drp_D, 8cuc_F, 7y3l_A, 3uk3_C, 5k5i_A, 1llm_D, 2wbs_A, 5yel_A, 7txc_E, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1p47_AB GGCGTGGGCGGCGTGGGCGT
1p47_B gGCGTGGGCGT
Binding Sites: 1p47_C
1p47_D
Publications: Peisach E, Pabo C.O. Constraints for zinc finger linker design as inferred from X-ray crystal structure of tandem Zif268-DNA complexes. Journal of molecular biology 330:1-7 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.