Transcription Factor

						

			
Accessions: 5v3m_C (3D-footprint 20231221)

			
Names: Zinc finger protein 568, ZN568_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 277
Pfam Domains:      1-17 C2H2-type zinc finger
     2-24 C2H2-type zinc finger
     2-24 Zinc finger, C2H2 type
    17-39 Zinc-finger double domain
    29-41 C2H2-type zinc finger
    30-52 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
    45-67 Zinc-finger double domain
    58-80 C2H2-type zinc finger
    58-69 C2H2-type zinc finger
    58-80 Zinc finger, C2H2 type
    72-96 Zinc-finger double domain
    85-96 C2H2-type zinc finger
   86-108 Zinc finger, C2H2 type
   86-108 C2H2-type zinc finger
  101-125 Zinc-finger double domain
  114-136 Zinc finger, C2H2 type
  114-136 C2H2-type zinc finger
  114-124 C2H2-type zinc finger
  131-151 Zinc-finger double domain
  141-151 C2H2-type zinc finger
  142-164 Zinc finger, C2H2 type
  142-164 C2H2-type zinc finger
  156-180 Zinc-finger double domain
  169-192 C2H2-type zinc finger
  170-192 Zinc finger, C2H2 type
  170-192 C2H2-type zinc finger
  185-209 Zinc-finger double domain
  197-220 C2H2-type zinc finger
  198-220 Zinc finger, C2H2 type
  198-220 C2H2-type zinc finger
  213-235 Zinc-finger double domain
  225-248 C2H2-type zinc finger
  226-248 C2H2-type zinc finger
  226-248 Zinc finger, C2H2 type
  241-264 Zinc-finger double domain
  253-274 C2H2-type zinc finger
  254-276 C2H2-type zinc finger
  254-276 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 PHKCKECGKAFHTPSQLSHHQKLHVGEKPYKCQECGKAFPSNAQLSLHHRVHTDEKCFEC   60
  61 KECGKAFMRPSHLLRHQRIHTGEKPHKCKECGKAFRYDTQLSLHLLTHAGARRFECKDCD  120
 121 KVYSCASQLALHQMSHTGEKPHKCKECGKGFISDSHLLRHQSVHTGETPYKCKECGKGFR  180
 181 RGSELARHQRAHSGDKPYKCKECGKSFTCTTELFRHQKVHTGDRPHKCKECGKAFIRRSE  240
 241 LTHHERSHSGEKPYECKECGKTFGRGSELSRHQKIHT
Interface Residues: 12, 13, 15, 16, 19, 23, 40, 41, 42, 43, 44, 47, 51, 68, 69, 70, 71, 72, 75, 97, 98, 99, 100, 101, 102, 103, 125, 127, 128, 131, 152, 153, 154, 155, 156, 159, 170, 180, 181, 182, 183, 184, 186, 187, 188, 189, 190, 193, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 219, 224, 236, 237, 238, 239, 240, 241, 242, 243, 264, 265, 266, 267, 268, 270, 271
3D-footprint Homologues: 7y3l_A, 7w1m_H, 8cuc_F, 8ssu_A, 5kkq_D, 8ssq_A, 7y3m_I, 1tf3_A, 5und_A, 3uk3_C, 5v3j_F, 5yj3_D, 8gn3_A, 5yel_A, 2i13_A, 6u9q_A, 7ysf_A, 1ubd_C, 1tf6_A, 6blw_A, 5ei9_F, 6wmi_A, 2kmk_A, 6ml4_A, 5k5i_A, 2gli_A, 7eyi_G, 4m9v_C, 6e94_A, 2jpa_A, 7n5w_A, 6jnm_A, 1g2f_F, 4x9j_A, 1mey_C, 5kl3_A, 8h9h_G, 2lt7_A, 6a57_A, 5k5l_F, 1llm_D, 2wbs_A, 7txc_E, 2drp_D, 1f2i_J
Binding Motifs: 5v3m_C GcCCTyntTACCTGTGCCACGCC
Binding Sites: 5v3m_A
5v3m_B
			
Publications: Patel A, Yang P, Tinkham M, Pradhan M, Sun MA, Wang Y, Hoang D, Wolf G, Horton JR, Zhang X, Macfarlan T, Cheng X. DNA Conformation Induces Adaptable Binding by Tandem Zinc Finger Proteins. Cell 173:221-233 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.