Transcription Factor

						

			
Accessions: 5v3g_A (3D-footprint 20231221)

			
Names: D9IWL3_HUMAN, EC 2.1.1.43, Fragment, PR domain zinc finger protein 9
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: D9IWL3
Length: 168
Pfam Domains:      5-27 Zinc finger, C2H2 type
     5-27 C2H2-type zinc finger
     5-27 C2H2-type zinc finger
    19-42 Zinc-finger double domain
    33-55 Zinc finger, C2H2 type
    33-55 C2H2-type zinc finger
    33-55 C2H2-type zinc finger
    47-70 Zinc-finger double domain
    61-83 Zinc finger, C2H2 type
    61-83 C2H2-type zinc finger
    61-83 C2H2-type zinc finger
    75-99 Zinc-finger double domain
   89-111 Zinc finger, C2H2 type
   89-111 C2H2-type zinc finger
   89-111 C2H2-type zinc finger
  104-126 Zinc-finger double domain
  117-139 Zinc finger, C2H2 type
  117-139 C2H2-type zinc finger
  117-139 C2H2-type zinc finger
  131-156 Zinc-finger double domain
  145-167 C2H2-type zinc finger
  145-167 Zinc finger, C2H2 type
  145-167 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 SEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLSHQRTHTGEKP   60
  61 YVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSWQSVLLRHQRTHTGEKPYVCR  120
 121 ECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFRNKSHLLRHQRTHT
Interface Residues: 16, 18, 19, 21, 22, 43, 44, 45, 46, 47, 50, 55, 61, 71, 72, 73, 74, 75, 76, 77, 78, 80, 81, 84, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 133, 134, 135, 156, 157, 158, 159, 160, 162, 163
3D-footprint Homologues: 1f2i_J, 5und_A, 8ssu_A, 6wmi_A, 5k5l_F, 1tf6_A, 7w1m_H, 5v3j_F, 4x9j_A, 2i13_A, 1llm_D, 5kkq_D, 5ei9_F, 5kl3_A, 8ssq_A, 7ysf_A, 2lt7_A, 3uk3_C, 2gli_A, 6ml4_A, 5yel_A, 6e94_A, 6dta_B, 2kmk_A, 1tf3_A, 6jnm_A, 7n5w_A, 6u9q_A, 5k5i_A, 1g2f_F, 6blw_A, 2wbs_A, 7eyi_G, 8h9h_G, 6a57_A, 2jpa_A, 1ubd_C, 8ebx_K, 8ebt_K, 8cuc_F, 7y3l_A, 2drp_D, 7txc_E, 1mey_C, 7y3m_I, 8gn3_A, 4m9v_C, 5yj3_D
Binding Motifs: 5v3g_A GGGnAACGCTCACTGGGGTC
Binding Sites: 5v3g_B
5v3g_C
			
Publications: Patel A, Zhang X, Blumenthal RM, Cheng X. Structural basis of human PR/SET domain 9 (PRDM9) allele C-specific recognition of its cognate DNA sequence. J Biol Chem 292:15994-16002 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.