Transcription Factor

Accessions: 5v3g_A (3D-footprint 20241219)
Names: D9IWL3_HUMAN, EC 2.1.1.43, Fragment, PR domain zinc finger protein 9
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: D9IWL3
Length: 168
Pfam Domains: 5-27 C2H2-type zinc finger
5-27 Zinc finger, C2H2 type
5-27 C2H2-type zinc finger
19-42 Zinc-finger double domain
33-55 C2H2-type zinc finger
33-55 C2H2-type zinc finger
33-55 Zinc finger, C2H2 type
47-70 Zinc-finger double domain
61-83 Zinc finger, C2H2 type
61-83 C2H2-type zinc finger
61-83 C2H2-type zinc finger
75-99 Zinc-finger double domain
89-111 Zinc finger, C2H2 type
89-111 C2H2-type zinc finger
89-111 C2H2-type zinc finger
104-126 Zinc-finger double domain
117-139 Zinc finger, C2H2 type
117-139 C2H2-type zinc finger
117-139 C2H2-type zinc finger
131-156 Zinc-finger double domain
145-167 Zinc finger, C2H2 type
145-167 C2H2-type zinc finger
145-167 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLSHQRTHTGEKP 60
61 YVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSWQSVLLRHQRTHTGEKPYVCR 120
121 ECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFRNKSHLLRHQRTHT
Interface Residues: 16, 18, 19, 21, 22, 43, 44, 46, 47, 50, 55, 61, 71, 72, 73, 74, 75, 77, 78, 80, 81, 84, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 133, 134, 156, 157, 158, 159, 162
3D-footprint Homologues: 5v3j_F, 1tf6_A, 8ssq_A, 8ssu_A, 7w1m_H, 7ysf_A, 2lt7_A, 2gli_A, 6e94_A, 6dta_B, 2kmk_A, 7n5w_A, 1tf3_A, 6u9q_A, 8h9h_G, 2jpa_A, 1ubd_C, 8ebt_K, 8ebx_K, 7y3l_A, 8cuc_F, 7txc_E, 2drp_D, 7y3m_I, 8gn3_A
Binding Motifs: 5v3g_A GGGnAACGCTCACTGGGGTC
Binding Sites: 5v3g_B
5v3g_C
Publications: Patel A, Zhang X, Blumenthal RM, Cheng X. Structural basis of human PR/SET domain 9 (PRDM9) allele C-specific recognition of its cognate DNA sequence. J Biol Chem 292:15994-16002 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.