Transcription Factor
Accessions: | 5v3g_A (3D-footprint 20231221) |
Names: | D9IWL3_HUMAN, EC 2.1.1.43, Fragment, PR domain zinc finger protein 9 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | D9IWL3 |
Length: | 168 |
Pfam Domains: | 5-27 Zinc finger, C2H2 type 5-27 C2H2-type zinc finger 5-27 C2H2-type zinc finger 19-42 Zinc-finger double domain 33-55 Zinc finger, C2H2 type 33-55 C2H2-type zinc finger 33-55 C2H2-type zinc finger 47-70 Zinc-finger double domain 61-83 Zinc finger, C2H2 type 61-83 C2H2-type zinc finger 61-83 C2H2-type zinc finger 75-99 Zinc-finger double domain 89-111 Zinc finger, C2H2 type 89-111 C2H2-type zinc finger 89-111 C2H2-type zinc finger 104-126 Zinc-finger double domain 117-139 Zinc finger, C2H2 type 117-139 C2H2-type zinc finger 117-139 C2H2-type zinc finger 131-156 Zinc-finger double domain 145-167 C2H2-type zinc finger 145-167 Zinc finger, C2H2 type 145-167 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 SEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLSHQRTHTGEKP 60 61 YVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSWQSVLLRHQRTHTGEKPYVCR 120 121 ECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFRNKSHLLRHQRTHT |
Interface Residues: | 16, 18, 19, 21, 22, 43, 44, 45, 46, 47, 50, 55, 61, 71, 72, 73, 74, 75, 76, 77, 78, 80, 81, 84, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 133, 134, 135, 156, 157, 158, 159, 160, 162, 163 |
3D-footprint Homologues: | 1f2i_J, 5und_A, 8ssu_A, 6wmi_A, 5k5l_F, 1tf6_A, 7w1m_H, 5v3j_F, 4x9j_A, 2i13_A, 1llm_D, 5kkq_D, 5ei9_F, 5kl3_A, 8ssq_A, 7ysf_A, 2lt7_A, 3uk3_C, 2gli_A, 6ml4_A, 5yel_A, 6e94_A, 6dta_B, 2kmk_A, 1tf3_A, 6jnm_A, 7n5w_A, 6u9q_A, 5k5i_A, 1g2f_F, 6blw_A, 2wbs_A, 7eyi_G, 8h9h_G, 6a57_A, 2jpa_A, 1ubd_C, 8ebx_K, 8ebt_K, 8cuc_F, 7y3l_A, 2drp_D, 7txc_E, 1mey_C, 7y3m_I, 8gn3_A, 4m9v_C, 5yj3_D |
Binding Motifs: | 5v3g_A GGGnAACGCTCACTGGGGTC |
Binding Sites: | 5v3g_B 5v3g_C |
Publications: | Patel A, Zhang X, Blumenthal RM, Cheng X. Structural basis of human PR/SET domain 9 (PRDM9) allele C-specific recognition of its cognate DNA sequence. J Biol Chem 292:15994-16002 (2017). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.