Transcription Factor

						

			
Accessions: 1a6y_B (3D-footprint 20231221)

			
Names: EAR-1, NR1D1_HUMAN, Nuclear receptor subfamily 1 group D member 1, ORPHAN NUCLEAR RECEPTOR NR1D1, Rev-erbA-alpha, V-erbA-related protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20393
Length: 84
Pfam Domains:      5-74 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 GMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQ   60
  61 QCRFKKCLSVGMSRDAVRFGRIPK
Interface Residues: 14, 15, 17, 18, 24, 25, 27, 28, 31, 32, 57, 79, 81, 83
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B
Binding Motifs: 1a6y_AB TGaCCnnnTGACCt
Binding Sites: 1a6y_D
1a6y_C
			
Publications: Zhao Q, Khorasanizadeh S, Miyoshi Y, Lazar M.A, Rastinejad F. Structural elements of an orphan nuclear receptor-DNA complex. Molecular cell 1:849-61 (1998). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.