Transcription Factor

Accessions: 6e33_A (3D-footprint 20231221)
Names: Uncharacterized transcriptional regulatory protein C27B12.11c, YBCB_SCHPO
Organisms: Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O13658
Length: 58
Pfam Domains: 12-48 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence:
(in bold interface residues)
1 GKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYK
Interface Residues: 9, 20, 21, 22, 46, 48, 54, 57
3D-footprint Homologues: 6o19_A, 2er8_C, 1hwt_C, 1pyi_A, 6gys_C, 1zme_D
Binding Motifs: 6e33_A TTCGGACnnTCAA
Binding Sites: 6e33_B
6e33_C
Publications: Garg A, Goldgur Y, Schwer B, Shuman S. Distinctive structural basis for DNA recognition by the fission yeast Zn2Cys6 transcription factor Pho7 and its role in phosphate homeostasis. Nucleic Acids Res 46:11262-11273 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.