Transcription Factor

Accessions: T14337 (AthalianaCistrome v4_May2016), Q9LTV4 (JASPAR 2024)
Names: AT3G12820, MYB10, T14337;, AtMYB10, Myb-related protein 10, MYB10_ARATH, Transcription factor MYB10
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2024 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB
Length: 239
Pfam Domains: 16-63 Myb-like DNA-binding domain
19-78 Myb-like DNA-binding domain
69-114 Myb-like DNA-binding domain
72-122 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MGNRRAPCCDKSQVKRGPWSDEESERLRSFILKNGHQNWRSLPKLAGLMRCGKSCRLRWI 60
61 NYLRPGLKRGNFTKEEEDTIIHLHQAYGNKWSKIASNFPGRTDNEIKNVWNTHLKKRLVK 120
121 RSISSSSSDVTNHSVSSTSSSSSSISSVLQDVIIKSERPNQEEEFGEILVEQMACGFEVD 180
181 APQSLECLFDDSQVPPPISKPDSLQTHGKSSDHEFWSRLIEPGFDDYNEWLIFLDNQTC
Interface Residues: 16, 51, 52, 53, 54, 56, 57, 61, 62, 91, 92, 103, 104, 107, 108, 111, 112, 113, 115, 116
3D-footprint Homologues: 1vfc_A, 3osg_A, 2kdz_A, 7xur_A, 3zqc_A, 6kks_A, 1mse_C, 1wte_A, 7c4r_A
Binding Motifs: M0546 dddwddGKTWGGTRrr
M0555 yyyYACCwAmCwww
MA1762.1 yyyYACCwAmCwww
MA1762.2 yYACCwAmCw
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.