Transcription Factor
| Accessions: | 5hlh_C (3D-footprint 20231221) |
| Names: | MarR family transcriptional regulator, Q5HKZ1_STAEQ |
| Organisms: | Staphylococcus epidermidis, strain ATCC 35984 / RP62A |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q5HKZ1 |
| Length: | 132 |
| Pfam Domains: | 27-84 Sugar-specific transcriptional regulator TrmB 31-89 MarR family 32-98 Winged helix DNA-binding domain 32-89 MarR family 37-105 HxlR-like helix-turn-helix 45-86 FeoC like transcriptional regulator 55-101 Transcriptional regulator PadR-like family |
| Sequence: (in bold interface residues) | 1 EQMRLANQLFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDL 60 61 SSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLYDETKYV 120 121 FEELEQTLKHLI |
| Interface Residues: | 52, 61, 62, 63, 64, 66, 67, 68, 70, 71, 88 |
| 3D-footprint Homologues: | 7el3_B, 6c2s_C, 3q5f_A, 6jbx_A, 4lln_I, 7dvv_A, 5yi2_J, 5h3r_A, 1z9c_A, 4fx4_B, 5hlg_E, 3zpl_B, 5f7q_C, 4aik_A, 5hso_A |
| Binding Motifs: | 5hlh_AC CGATTnAGnnnnCTnAATCG |
| Binding Sites: | 5hlh_I 5hlh_J |
| Publications: | Liu G, Liu X, Xu H, Liu X, Zhou H, Huang Z, Gan J, Chen H, Lan L, Yang CG. Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR. J Am Chem Soc 139:1598-1608 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.