Transcription Factor
Accessions: | ECK120008346 (RegulonDB 7.5) |
Names: | IscR, IscR DNA-binding transcriptional dual regulator |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | The transcription factor IscR, for Iron-sulfur cluster Regulator, is negatively autoregulated, and it contains an iron-sulfur cluster that could act as a sensor of iron-sulfur cluster assembly Schwartz CJ,2001; Giel JL,2006 This protein regulates the expression of the operons that encode components of a secondary pathway of iron-sulfur cluster assembly, iron-sulfur proteins, anaerobic respiration enzymes, and biofilm formation Tokumoto U,2001; Schwartz CJ,2001; Giel JL,2006; Lee KC,2008; Yeo WS,2006; Wu Y,2009IscR is a member of the Rrf2 family Nesbit AD,2009and carries a predicted N-terminal helix-turn-helix DNA-binding motif and three conserved cysteines in its C terminus; IscR is a dimer in solution Nesbit AD,2009 and it contains the [2Fe-2S]1+ cluster when purified under anaerobic conditions Schwartz CJ,2001Two types of DNA-binding sites have been described for IscR: type 1 and type 2. Both sites resemble 25-bp imperfect palindromes but differ in their sequence Giel JL,2006; Nesbit AD,2009 IscR requires the iron-sulfur cluster for its activity when bound to type 1 sites; PiscR contains two type 1 sites Giel JL,2006 Therefore, under conditions when Fe-S cluster assembly becomes rate limiting, levels of [2Fe-2S]-containing IscR may decrease due to a lower rate of its synthesis, thus relieving repression of the iscRSUA operon for the biogenesis of the iron-sulfur cluster Schwartz CJ,2001; Frazzon J,2001 In contrast, for the regulation of promoters containing type 2 sites, such as PsufA, the [2Fe-2S] cluster of IscR is dispensable Yeo WS,2006; Lee KC,2008IscR binds cooperatively to DNA, and four protomers bind to one palindromic site Nesbit AD,2009; Transcription related; repressor; activator; operon; 2 iron, 2 sulfur cluster binding; iron-sulfur cluster binding; metal ion binding; response to stress; regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity; double-stranded DNA binding; DNA binding; transcription activator activity; transcription, DNA- dependent; transcription repressor activity |
Length: | 163 |
Pfam Domains: | 1-83 Transcriptional regulator |
Sequence: (in bold interface residues) | 1 MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG 60 61 PGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGF 120 121 LNNITLGELVNNQEVLDVSGRQHTHDAPRTRTQDAIDVKLRA* |
Interface Residues: | 28, 38, 39, 40, 41, 43, 44, 47, 48, 51, 59, 61, 62 |
3D-footprint Homologues: | 2xro_E, 4on0_B, 2isz_B, 1u8r_B, 4hf1_A, 6y42_B, 7b0c_A, 1xs9_A, 2heo_D |
Binding Motifs: | IscR wAwmCCCwdswAAhdbrrKsrw |
Binding Sites: | ECK120017137 ECK120020692 ECK120020694 ECK120020696 ECK120020698 ECK120020700 ECK120020702 ECK120020704 ECK120033121 ECK120033123 ECK125109307 |
Publications: | Schwartz CJ., Giel JL., Patschkowski T., Luther C., Ruzicka FJ., Beinert H., Kiley PJ. IscR, an Fe-S cluster-containing transcription factor, represses expression of Escherichia coli genes encoding Fe-S cluster assembly proteins. Proc Natl Acad Sci U S A. 98(26):14895-900 (2001). [Pubmed] Giel JL., Rodionov D., Liu M., Blattner FR., Kiley PJ. IscR-dependent gene expression links iron-sulphur cluster assembly to the control of O-regulated genes in Escherichia coli. Mol Microbiol. 60(4):1058-75 (2006). [Pubmed] Tokumoto U., Takahashi Y. Genetic analysis of the isc operon in Escherichia coli involved in the biogenesis of cellular iron-sulfur proteins. J Biochem (Tokyo). 130(1):63-71 (2001). [Pubmed] Lee KC., Yeo WS., Roe JH. Oxidant-responsive induction of the suf operon, encoding a Fe-S assembly system, through Fur and IscR in Escherichia coli. J Bacteriol. 190(24):8244-7 (2008). [Pubmed] Yeo WS., Lee JH., Lee KC., Roe JH. IscR acts as an activator in response to oxidative stress for the suf operon encoding Fe-S assembly proteins. Mol Microbiol. 61(1):206-18 (2006). [Pubmed] Wu Y., Outten FW. IscR controls iron-dependent biofilm formation in Escherichia coli by regulating type I fimbria expression. J Bacteriol. 191(4):1248-57 (2009). [Pubmed] Nesbit AD., Giel JL., Rose JC., Kiley PJ. Sequence-specific binding to a subset of IscR-regulated promoters does not require IscR Fe-S cluster ligation. J Mol Biol. 387(1):28-41 (2009). [Pubmed] Frazzon J., Dean DR. Feedback regulation of iron-sulfur cluster biosynthesis. Proc Natl Acad Sci U S A. 98(26):14751-3 (2001). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.