Transcription Factor
| Accessions: | 1vtn_C (3D-footprint 20231221) |
| Names: | Fork head-related protein FKH H3, Forkhead box protein A3, FOXA3_HUMAN, Hepatocyte nuclear factor 3-gamma, HNF-3-gamma, HNF-3/FORK HEAD DNA-RECOGNITION MOTIF, HNF-3G, TCF-3G, Transcription factor 3G |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P55318 |
| Length: | 102 |
| Pfam Domains: | 3-98 Fork head domain |
| Sequence: (in bold interface residues) | 1 HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDC 60 61 FVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA |
| Interface Residues: | 43, 46, 48, 49, 50, 52, 53, 54, 56, 57, 66, 73, 98 |
| 3D-footprint Homologues: | 3l2c_A, 7vox_H, 2hdc_A, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 3qrf_G |
| Binding Motifs: | 1vtn_C CTannTCAA |
| Binding Sites: | 1vtn_A 1vtn_B |
| Publications: | Clark K. L., Halay E. D., Lai E., Burley S. K. Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5. Nature 364:412-420 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.