Transcription Factor

Accessions: 1vtn_C (3D-footprint 20231221)
Names: Fork head-related protein FKH H3, Forkhead box protein A3, FOXA3_HUMAN, Hepatocyte nuclear factor 3-gamma, HNF-3-gamma, HNF-3/FORK HEAD DNA-RECOGNITION MOTIF, HNF-3G, TCF-3G, Transcription factor 3G
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P55318
Length: 102
Pfam Domains: 3-98 Fork head domain
Sequence:
(in bold interface residues)
1 HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDC 60
61 FVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA
Interface Residues: 43, 46, 48, 49, 50, 52, 53, 54, 56, 57, 66, 73, 98
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 3qrf_G
Binding Motifs: 1vtn_C CTannTCAA
Binding Sites: 1vtn_A
1vtn_B
Publications: Clark K. L., Halay E. D., Lai E., Burley S. K. Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5. Nature 364:412-420 (1993). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.