Transcription Factor

Accessions: 4wlw_A (3D-footprint 20231221)
Names: Copper efflux regulator, Copper export regulator, CUER_ECOLI, HTH-type transcriptional regulator CueR
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A9G4
Length: 130
Pfam Domains: 1-67 MerR HTH family regulatory protein
2-39 MerR family regulatory protein
45-108 MerR, DNA binding
Sequence:
(in bold interface residues)
1 MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNL 60
61 EESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADC 120
121 PIIENLSGCC
Interface Residues: 15, 18, 19, 22, 23, 36, 37
3D-footprint Homologues: 6xl5_H, 4r24_B, 6jgx_B, 1r8e_A, 7ckq_G, 4r4e_B, 6ldi_G, 2vz4_A, 7tea_B, 5c8e_C, 6xh7_H, 2zhg_A, 7tec_A, 5d8c_A, 1r8d_B
Binding Motifs: 4wlw_A CcntCCAG
Binding Sites: 4wlw_X
4wlw_Y
Publications: Philips SJ, Canalizo-Hernandez M, Yildirim I, Schatz GC, Mondragón A, O'Halloran TV. TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter 349:877-81 (Science.). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.