Transcription Factor
| Accessions: | T037191_1.02 (CISBP 1.02) |
| Names: | C46E10.8, T037191_1.02; |
| Organisms: | Caenorhabditis elegans |
| Libraries: | CISBP 1.02 1 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 172 |
| Pfam Domains: | 29-49 Zinc finger, C2H2 type 29-50 Zinc-finger of C2H2 type 29-50 C2H2-type zinc finger 64-86 Zinc finger, C2H2 type 64-86 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MDLPVTPGAPNFAQLLDPVHSQELGKFVYQCKACSRIYASRKSLKSHLKSYKYAREVAGY 60 61 KSKHTCEICGAHYSSKIYLNRHMKKHLETADSGAHAIPSLGSPAPSSSGFATMIVPPAPL 120 121 LSAISSGSPQLGDTRVLASFSCFAPMISPPSQLLSSIQSDQAASQHNHLERC |
| Interface Residues: | 14, 39, 40, 41, 42, 43, 45, 46, 47, 55, 56, 57, 59, 60, 74, 75, 76, 77, 78, 79, 81, 82, 85, 158, 160 |
| 3D-footprint Homologues: | 1g2f_F, 2kmk_A, 8cuc_F, 7y3l_A, 5ei9_F, 6ml4_A, 5kl3_A, 7w1m_H, 8gn3_A, 6u9q_A, 4x9j_A, 1llm_D, 8h9h_G, 7n5w_A, 2drp_D, 4m9v_C, 7y3m_I, 2lt7_A, 6e94_A, 2wbs_A, 3uk3_C, 7txc_E, 5yj3_D, 6ppr_B |
| Binding Motifs: | M0385_1.02 GgkyadrAaw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.