Transcription Factor

						

			
Accessions: ZNF174 (HT-SELEX2 May2017)

			
Names: ENSG00000103343, ZNF174
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 103
Pfam Domains:     19-32 Zinc-finger double domain
    21-32 C2H2-type zinc finger
    22-44 C2H2-type zinc finger
    22-44 Zinc finger, C2H2 type
    37-60 Zinc-finger double domain
    49-64 C2H2-type zinc finger
    50-72 C2H2-type zinc finger
    50-72 Zinc finger, C2H2 type
    65-88 Zinc-finger double domain
   78-101 C2H2-type zinc finger
   78-101 C2H2-type zinc finger
   78-100 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 RSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECGNCFG   60
  61 RQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Interface Residues: 5, 7, 8, 11, 13, 14, 17, 22, 32, 33, 34, 35, 36, 38, 39, 40, 43, 60, 61, 62, 63, 64, 65, 66, 67, 68, 74, 75, 88, 89, 90, 91, 92, 93, 94, 95, 99
3D-footprint Homologues: 6ml4_A, 2gli_A, 5ei9_F, 2i13_A, 2jpa_A, 2kmk_A, 7y3l_A, 7n5w_A, 1tf3_A, 6jnm_A, 8cuc_F, 5k5i_A, 8ssu_A, 8gn3_A, 1llm_D, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 4x9j_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 8ssq_A, 7w1m_H, 5und_A, 1g2f_F, 7eyi_G, 5v3j_F, 4m9v_C, 8h9h_G, 1tf6_A, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 3uk3_C, 5yel_A, 7txc_E, 2wbs_A, 5yj3_D, 2drp_D, 1yuj_A
Binding Motifs: ZNF174_2 kGsCrrTCACTyGcCa
ZNF174_methyl_1 bgcCrATCACTyGcCm
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.