Transcription Factor
| Accessions: | ZNF174 (HT-SELEX2 May2017) |
| Names: | ENSG00000103343, ZNF174 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 103 |
| Pfam Domains: | 19-32 Zinc-finger double domain 21-32 C2H2-type zinc finger 22-44 C2H2-type zinc finger 22-44 Zinc finger, C2H2 type 37-60 Zinc-finger double domain 49-64 C2H2-type zinc finger 50-72 C2H2-type zinc finger 50-72 Zinc finger, C2H2 type 65-88 Zinc-finger double domain 78-100 Zinc finger, C2H2 type 78-101 C2H2-type zinc finger 78-101 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECGNCFG 60 61 RQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD |
| Interface Residues: | 5, 7, 8, 11, 13, 14, 17, 22, 32, 33, 34, 35, 36, 38, 39, 40, 43, 60, 61, 62, 63, 64, 65, 66, 67, 68, 74, 75, 88, 89, 90, 91, 92, 93, 94, 95, 99 |
| 3D-footprint Homologues: | 2gli_A, 5ei9_F, 6ml4_A, 2jpa_A, 2kmk_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 7w1m_H, 6blw_A, 5k5i_A, 6u9q_A, 8ssu_A, 1f2i_J, 5kkq_D, 8gn3_A, 4x9j_A, 1g2f_F, 5kl3_A, 1ubd_C, 1llm_D, 7ysf_A, 8ssq_A, 4m9v_C, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 1tf6_A, 7y3m_I, 6a57_A, 3uk3_C, 5yel_A, 2drp_D, 5yj3_D, 2wbs_A, 7txc_E, 1yuj_A |
| Binding Motifs: | ZNF174_2 kGsCrrTCACTyGcCa ZNF174_methyl_1 bgcCrATCACTyGcCm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.