Transcription Factor

Accessions: ZNF174 (HT-SELEX2 May2017)
Names: ENSG00000103343, ZNF174
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 103
Pfam Domains: 19-32 Zinc-finger double domain
21-32 C2H2-type zinc finger
22-44 C2H2-type zinc finger
22-44 Zinc finger, C2H2 type
37-60 Zinc-finger double domain
49-64 C2H2-type zinc finger
50-72 C2H2-type zinc finger
50-72 Zinc finger, C2H2 type
65-88 Zinc-finger double domain
78-101 C2H2-type zinc finger
78-100 Zinc finger, C2H2 type
78-101 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 RSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECGNCFG 60
61 RQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Interface Residues: 5, 7, 8, 11, 13, 14, 17, 22, 32, 33, 34, 35, 36, 38, 39, 40, 43, 60, 61, 62, 63, 64, 65, 66, 67, 68, 74, 75, 88, 89, 90, 91, 92, 93, 94, 95, 99
3D-footprint Homologues: 2gli_A, 5ei9_F, 6ml4_A, 2jpa_A, 2kmk_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 6u9q_A, 8ssu_A, 1f2i_J, 5kkq_D, 8gn3_A, 4x9j_A, 1g2f_F, 5kl3_A, 1ubd_C, 1llm_D, 7ysf_A, 4m9v_C, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 1tf6_A, 7y3m_I, 6a57_A, 3uk3_C, 5yel_A, 2drp_D, 5yj3_D, 2wbs_A, 7txc_E, 1yuj_A
Binding Motifs: ZNF174_2 kGsCrrTCACTyGcCa
ZNF174_methyl_1 bgcCrATCACTyGcCm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.