Transcription Factor

						

			
Accessions: 5ef6_J (3D-footprint 20231221), 5no6_A (3D-footprint 20231221), 5no6_B (3D-footprint 20231221)

			
Names: Homeobox protein Hox-B13, HXB13_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q92826
Length: 62
Pfam Domains:      1-57 Homeobox domain
Sequence: 
(in bold interface residues)		   1 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA   60
  61 KV
Interface Residues: 1, 2, 3, 4, 12, 28, 30, 42, 43, 45, 46, 49, 50, 53, 54, 57
3D-footprint Homologues: 2h1k_B, 1puf_A, 3cmy_A, 6a8r_A, 1fjl_B, 5zfz_A, 1ig7_A, 2lkx_A, 1nk2_P, 1zq3_P, 7q3o_C, 6es3_K, 2ld5_A, 3a01_E, 5zjt_E, 4cyc_A, 1jgg_B, 2hdd_A, 7psx_B, 2r5y_A, 6m3d_C, 1au7_A, 5jlw_D, 3lnq_A, 2hos_A, 4xrs_G, 1b72_A, 3rkq_B, 5flv_I, 6vz3_A, 6vu3_A, 1e3o_C, 2xsd_C, 1le8_A, 1le8_B, 1du0_A, 6fqq_E, 5hod_A, 1mnm_C, 4qtr_D, 1puf_B, 1k61_B, 1o4x_A, 7xrc_C, 6fqp_B
Binding Motifs: 5ef6_J TtTa
5no6_AN GGAATgcnATAaA
5no6_BI GAATGynATAAm
Binding Sites: 5ef6_K
5ef6_L
			
Publications: Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.