Transcription Factor

Accessions: ZSCAN31 (HT-SELEX2 May2017), ZSCAN31 (humanC2H2ZF-ChIP Feb2015), Q96LW9 (JASPAR 2024)
Names: ENSG00000235109, ZSCAN31, Q96LW9, Zinc finger and SCAN domain-containing protein 31, Zinc finger protein 323, ZSC31_HUMAN
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, humanC2H2ZF-ChIP Feb2015 2, JASPAR 2024 3
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4, TF family: C2H2;SCAN experiment: ChIP-seq/MEME/B1H-RC
Length: 406
Pfam Domains: 35-127 SCAN domain
239-261 C2H2-type zinc finger
239-261 Zinc finger, C2H2 type
239-259 C2H2-type zinc finger
254-278 Zinc-finger double domain
266-289 C2H2-type zinc finger
267-289 C2H2-type zinc finger
267-289 Zinc finger, C2H2 type
281-305 Zinc-finger double domain
295-315 C2H2-type zinc finger
295-317 C2H2-type zinc finger
295-317 Zinc finger, C2H2 type
310-332 Zinc-finger double domain
322-332 C2H2-type zinc finger
323-345 Zinc finger, C2H2 type
323-345 C2H2-type zinc finger
338-360 Zinc-finger double domain
351-373 Zinc finger, C2H2 type
351-360 C2H2-type zinc finger
351-373 C2H2-type zinc finger
367-389 Zinc-finger double domain
379-401 Zinc finger, C2H2 type
379-397 C2H2-type zinc finger
379-401 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRL 60
61 RELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE 120
121 LSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGE 180
181 SIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHR 240
241 CNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC 300
301 GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF 360
361 IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP
Interface Residues: 167, 169, 229, 249, 250, 251, 252, 253, 255, 256, 258, 259, 260, 262, 267, 277, 278, 279, 280, 281, 283, 284, 285, 305, 306, 307, 308, 309, 310, 311, 312, 313, 316, 333, 334, 335, 336, 337, 339, 340, 343, 361, 362, 363, 364, 365, 368, 390, 392, 393, 394, 396
3D-footprint Homologues: 5ux0_A, 1ubd_C, 7y3l_A, 3uk3_C, 7n5w_A, 6jnm_A, 8cuc_F, 2drp_D, 5v3j_F, 2gli_A, 8ssq_A, 7w1m_H, 5kkq_D, 8ssu_A, 8h9h_G, 6a57_A, 2jpa_A, 2kmk_A, 1tf3_A, 1g2f_F, 5kl3_A, 1llm_D, 7txc_E, 5k5l_F, 6ml4_A, 4x9j_A, 1f2i_J, 6blw_A, 2wbs_A, 1tf6_A, 6u9q_A, 5ei9_F, 4m9v_C, 6e94_A, 7y3m_I, 5yel_A, 5k5i_A, 2lt7_A, 7ysf_A, 8gn3_A, 5yj3_D
Binding Motifs: MA1722.1 / UN0247.1 / ZSCAN31_2 GCATAAyTGCCCTGCkkCc
ZSCAN31_methyl_1 GCATAAyTGCCCyGCdkCc
ZSCAN31_ChIP amAAcCAATTAA
MA1722.2 GCATAAyTGCCCTGCkkC
Publications: Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.