Transcription Factor
| Accessions: | 3hdd_B (3D-footprint 20231221) |
| Names: | ENGRAILED HOMEODOMAIN, HMEN_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02836 |
| Length: | 56 |
| Pfam Domains: | 1-56 Homeobox domain |
| Sequence: (in bold interface residues) | 1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKK |
| Interface Residues: | 1, 2, 3, 41, 42, 44, 45, 48, 49, 52, 53, 56 |
| 3D-footprint Homologues: | 3lnq_A, 1jgg_B, 6m3d_C, 2lkx_A, 1zq3_P, 1ig7_A, 5zjt_E, 4j19_B, 3a01_E, 2d5v_B, 5hod_A, 2ld5_A, 1puf_A, 6a8r_A, 3cmy_A, 2h1k_B, 5jlw_D, 3rkq_B, 6es3_K, 1au7_A, 4xrs_G, 3d1n_M, 2hdd_A, 1nk2_P, 7psx_B, 1fjl_B, 5zfz_A, 4cyc_A, 2r5y_A, 1b72_A, 5flv_I, 2hos_A, 7q3o_C, 1e3o_C, 1le8_A, 1le8_B, 6fqq_E, 1du0_A, 8g87_X, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B, 6fqp_B, 3l1p_A, 1o4x_A |
| Binding Motifs: | 3hdd_AB GTAATAACnTTA |
| Binding Sites: | 3hdd_C 3hdd_D |
| Publications: | Fraenkel E, Rould M.A, Chambers K.A, Pabo C.O. Engrailed homeodomain-DNA complex at 2.2 A resolution: a detailed view of the interface and comparison with other engrailed structures. Journal of molecular biology 284:351-61 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.