Transcription Factor

Accessions: T020115_1.02 (CISBP 1.02), A9TN45 (JASPAR 2024)
Names: gw1.270.82.1, T020115_1.02;, A9TN45_PHYPA, Fragment, Predicted protein
Organisms: Physcomitrella patens, moss
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:bHLH
Length: 160
Pfam Domains: 79-126 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 TSTSSVVSDGKNSKSLEANEQTSLKRQRSGLVKAERSASENSGDSASPRSLKATSKPPQD 60
61 LSKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKITGKAVMLDEIIN 120
121 YVQSLQRQIEFLSMKLAAVNPRLDYSYDLLGKDMLQSRSP
Interface Residues: 80, 81, 83, 84, 87, 88, 111
3D-footprint Homologues: 5v0l_A, 1a0a_B, 7xi3_A, 5eyo_A, 6g1l_A, 1am9_A, 8ia3_B, 5gnj_I, 7d8t_A, 4h10_A, 5nj8_D, 7ssa_L, 4zpk_A, 8osl_P
Binding Motifs: M0252_1.02 cCACGTGc
MA1021.1 cCACGTGc
Publications: Fernández-Calvo P, Chini A, Fernández-Barbero G, Chico J.M, Gimenez-Ibanez S, Geerinck J, Eeckhout D, Schweizer F, Godoy M, Franco-Zorrilla J.M, Pauwels L, Witters E, Puga M.I, Paz-Ares J, Goossens A, Reymond P, De Jaeger G, Solano R. The Arabidopsis bHLH transcription factors MYC3 and MYC4 are targets of JAZ repressors and act additively with MYC2 in the activation of jasmonate responses. The Plant cell 23:701-15 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.