Transcription Factor
| Accessions: | T044445_1.02 (CISBP 1.02), GFI1_HUMAN (HOCOMOCO 10), Q99684 (JASPAR 2024) |
| Names: | GFI1, T044445_1.02;, GFI1_HUMAN, Growth factor independent protein 1, Zinc finger protein 163, Zinc finger protein Gfi-1 |
| Organisms: | Homo sapiens |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q99684 |
| Notes: | family:C2H2 ZF |
| Length: | 422 |
| Pfam Domains: | 255-278 C2H2-type zinc finger 255-278 Zinc finger, C2H2 type 270-295 Zinc-finger double domain 284-306 C2H2-type zinc finger 284-306 Zinc finger, C2H2 type 285-308 C2H2-type zinc finger 298-323 Zinc-finger double domain 312-334 Zinc finger, C2H2 type 312-331 Zinc-finger of C2H2 type 312-334 C2H2-type zinc finger 314-330 C2H2-type zinc finger 327-350 Zinc-finger double domain 340-362 Zinc finger, C2H2 type 340-349 C2H2-type zinc finger 340-358 C2H2-type zinc finger 355-378 Zinc-finger double domain 367-390 C2H2-type zinc finger 368-390 Zinc finger, C2H2 type 368-390 C2H2-type zinc finger 382-405 Zinc-finger double domain 396-419 C2H2-type zinc finger 397-419 Zinc finger, C2H2 type 398-419 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQ 60 61 LTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFK 120 121 PYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAG 180 181 APGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVE 240 241 SELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLE 300 301 QHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF 360 361 IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG 420 421 LK |
| Interface Residues: | 266, 268, 269, 272, 276, 294, 295, 296, 297, 298, 301, 302, 305, 312, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 335, 350, 351, 352, 353, 354, 356, 357, 360, 378, 379, 380, 381, 382, 384, 385, 406, 407, 408, 409, 410, 411, 412, 413, 417 |
| 3D-footprint Homologues: | 8ssu_A, 5v3j_F, 8ssq_A, 5kkq_D, 1tf6_A, 7y3m_I, 8gh6_A, 6jnm_A, 5k5i_A, 7w1m_H, 4m9v_C, 7ysf_A, 6e94_A, 5yel_A, 2kmk_A, 7n5w_A, 5ei9_F, 8gn3_A, 6ml4_A, 2drp_D, 2gli_A, 8h9h_G, 2lt7_A, 6a57_A, 2jpa_A, 1ubd_C, 3uk3_C, 1tf3_A, 1g2f_F, 5kl3_A, 7txc_E, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 1f2i_J, 2wbs_A, 8cuc_F, 7y3l_A, 1llm_D, 5yj3_D |
| Binding Motifs: | M3341_1.02 gksryatrCwsWGATTTrkyykkt GFI1_HUMAN.H10MO.C|M01187 rCwstGATTt MA0038.2 cmAATCACdGCa MA0038.3 mAATCACdGCa |
| Publications: | Zweidler-McKay P. A., Grimes H. L., Flubacher M. M., Tsichlis P. N. Gfi-1 encodes a nuclear zinc finger protein that binds DNA and functions as a transcriptional repressor. Mol. Cell. Biol. 16:4024-4034 (1996). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.