Transcription Factor

Accessions: T044445_1.02 (CISBP 1.02), GFI1_HUMAN (HOCOMOCO 10), Q99684 (JASPAR 2024)
Names: GFI1, T044445_1.02;, GFI1_HUMAN, Growth factor independent protein 1, Zinc finger protein 163, Zinc finger protein Gfi-1
Organisms: Homo sapiens
Libraries: CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q99684
Notes: family:C2H2 ZF
Length: 422
Pfam Domains: 255-278 C2H2-type zinc finger
255-278 Zinc finger, C2H2 type
270-295 Zinc-finger double domain
284-306 C2H2-type zinc finger
284-306 Zinc finger, C2H2 type
285-308 C2H2-type zinc finger
298-323 Zinc-finger double domain
312-334 Zinc finger, C2H2 type
312-331 Zinc-finger of C2H2 type
312-334 C2H2-type zinc finger
314-330 C2H2-type zinc finger
327-350 Zinc-finger double domain
340-362 Zinc finger, C2H2 type
340-349 C2H2-type zinc finger
340-358 C2H2-type zinc finger
355-378 Zinc-finger double domain
367-390 C2H2-type zinc finger
368-390 Zinc finger, C2H2 type
368-390 C2H2-type zinc finger
382-405 Zinc-finger double domain
396-419 C2H2-type zinc finger
397-419 Zinc finger, C2H2 type
398-419 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQ 60
61 LTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFK 120
121 PYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAG 180
181 APGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVE 240
241 SELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLE 300
301 QHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF 360
361 IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG 420
421 LK
Interface Residues: 266, 268, 269, 272, 276, 294, 295, 296, 297, 298, 301, 302, 305, 312, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 335, 350, 351, 352, 353, 354, 356, 357, 360, 378, 379, 380, 381, 382, 384, 385, 406, 407, 408, 409, 410, 411, 412, 413, 417
3D-footprint Homologues: 8ssu_A, 5v3j_F, 8ssq_A, 5kkq_D, 1tf6_A, 7y3m_I, 8gh6_A, 6jnm_A, 5k5i_A, 7w1m_H, 4m9v_C, 7ysf_A, 6e94_A, 5yel_A, 2kmk_A, 7n5w_A, 5ei9_F, 8gn3_A, 6ml4_A, 2drp_D, 2gli_A, 8h9h_G, 2lt7_A, 6a57_A, 2jpa_A, 1ubd_C, 3uk3_C, 1tf3_A, 1g2f_F, 5kl3_A, 7txc_E, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 1f2i_J, 2wbs_A, 8cuc_F, 7y3l_A, 1llm_D, 5yj3_D
Binding Motifs: M3341_1.02 gksryatrCwsWGATTTrkyykkt
GFI1_HUMAN.H10MO.C|M01187 rCwstGATTt
MA0038.2 cmAATCACdGCa
MA0038.3 mAATCACdGCa
Publications: Zweidler-McKay P. A., Grimes H. L., Flubacher M. M., Tsichlis P. N. Gfi-1 encodes a nuclear zinc finger protein that binds DNA and functions as a transcriptional repressor. Mol. Cell. Biol. 16:4024-4034 (1996). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.