Transcription Factor
| Accessions: | T023874_1.02 (CISBP 1.02), Q39163 (JASPAR 2024), T23365 (AthalianaCistrome v4_May2016), TGA5 (EEADannot 2023-12-22) |
| Names: | OBF5, T023874_1.02;, AtbZIP26, bZIP transcription factor 26, Ocs element-binding factor 5, TGA5_ARATH, Transcription factor TGA5, AT5G06960, T23365;, TGA5, Q39163;TGA5_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3, EEADannot 2023-12-22 4 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 4 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | experiment type:PBM, family:bZIP, ecotype:Col-0, experiment type: DAP-seq |
| Length: | 330 |
| Pfam Domains: | 44-88 Basic region leucine zipper 45-86 bZIP transcription factor 127-205 Seed dormancy control |
| Sequence: (in bold interface residues) | 1 MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARK 60 61 SRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRR 120 121 WQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWK 180 181 TPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQ 240 241 SLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTT 300 301 RQSARALLAVHNYTLRLRALSSLWLARPRE |
| Interface Residues: | 54, 57, 58, 61, 62 |
| 3D-footprint Homologues: | 1dh3_C |
| Binding Motifs: | M0270_1.02 rTGACGTm MA1047.1 rTGACGTm M0214 drTGACGTCAkCaw MA1047.2 wwgaTGACGTCAycw EEAD0136 dwtGmTGACGTCAyh EEAD0137 tGrwGawGRwGAwGa MA1047.3 aTGACGTCA |
| Binding Sites: | MA1047.3.15 / MA1047.3.2 MA1047.1.1 MA1047.1.10 MA1047.1.11 MA1047.1.12 MA1047.1.13 MA1047.1.14 MA1047.1.15 MA1047.1.16 MA1047.1.17 MA1047.1.18 MA1047.1.19 MA1047.1.2 MA1047.1.20 MA1047.1.3 MA1047.1.4 MA1047.1.5 / MA1047.1.6 MA1047.1.7 MA1047.1.8 MA1047.1.9 MA1047.2.1 MA1047.2.10 MA1047.2.11 / MA1047.2.7 MA1047.2.12 MA1047.2.13 / MA1047.2.8 MA1047.2.14 MA1047.2.15 MA1047.2.16 MA1047.2.17 MA1047.2.18 / MA1047.2.9 MA1047.2.19 MA1047.2.1 / MA1047.2.2 MA1047.2.10 / MA1047.2.20 MA1047.2.3 MA1047.2.2 / MA1047.2.4 MA1047.2.3 / MA1047.2.5 MA1047.2.4 / MA1047.2.6 MA1047.2.5 / MA1047.2.7 MA1047.2.6 / MA1047.2.8 MA1047.2.9 MA1047.2.11 MA1047.2.12 MA1047.2.13 MA1047.2.14 MA1047.2.15 MA1047.2.16 MA1047.2.17 MA1047.2.18 MA1047.2.19 MA1047.2.20 MA1047.3.1 / MA1047.3.10 MA1047.3.11 / MA1047.3.13 MA1047.3.12 / MA1047.3.14 MA1047.3.16 MA1047.3.17 / MA1047.3.18 / MA1047.3.19 / MA1047.3.20 / MA1047.3.3 MA1047.3.4 / MA1047.3.5 MA1047.3.6 MA1047.3.7 MA1047.3.8 MA1047.3.9 |
| Publications: | Izawa T., Foster R., Chua N.-H. Plant bZIP protein DNA binding specificity.. J. Mol. Biol. 230:1131-1144 (1993). [Pubmed] Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.