Transcription Factor

						

			
Accessions: 1r0n_B (3D-footprint 20231221)

			
Names: 20-hydroxy-ecdysone receptor, 20E receptor, Ecdysone receptor, Ecdysteroid receptor, ECR_DROME, EcRH, Nuclear receptor subfamily 1 group H member 1
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P34021
Length: 86
Pfam Domains:      2-69 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRL   60
  61 KKCLAVGMRPECVVPENQCAMKRREK
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53, 77, 82
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E
Binding Motifs: 1r0n_AB GGnCAnTGaCC
1r0n_B TgaCC
Binding Sites: 1r0n_C
1r0n_D
			
Publications: Devarakonda S, Harp J.M, Kim Y, Ozyhar A, Rastinejad F. Structure of the heterodimeric ecdysone receptor DNA-binding complex. The EMBO journal 22:5827-40 (2003). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.