Transcription Factor
| Accessions: | 6mg1_A (3D-footprint 20260701), 6mg1_B (3D-footprint 20260701) |
| Names: | C/EBP beta, CCAAT/enhancer-binding protein beta, CEBPB_HUMAN, LAP, LIP, Liver activator protein, Liver-enriched inhibitory protein, Nuclear factor NF-IL6, TCF-5, Transcription factor 5 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P17676 |
| Length: | 70 |
| Pfam Domains: | 2-55 Basic region leucine zipper 3-61 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 KHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLR 60 61 NLFKQLPEPL |
| Interface Residues: | 10, 13, 14, 16, 17, 20, 21 |
| 3D-footprint Homologues: | 8k8c_A, 6mg1_B, 8k86_A, 2c9l_Z, 2dgc_A |
| Binding Motifs: | 6mg1_AB ATTgCGnAAt |
| Binding Sites: | 6mg1_C 6mg1_D |
| Publications: | Yang J, Horton JR, Wang D, Ren R, Li J, Sun D, Huang Y, Zhang X, Blumenthal RM, Cheng X. Structural basis for effects of CpA modifications on C/EBPβ binding of DNA. Nucleic Acids Res : (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.