Transcription Factor

Accessions: 2h27_A (3D-footprint 20250804)
Names: ECF RNA polymerase sigma-E factor, RNA polymerase Sigma E factor, RPOE_ECOLI, Sigma-24
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0AGB6
Length: 71
Pfam Domains: 9-61 Sigma-70, region 4
15-64 ECF sigma factor
16-61 Sigma-70, region 4
Sequence:
(in bold interface residues)
1 SHMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRARE 60
61 AIDNKVQPLIR
Interface Residues: 37, 50, 52, 53, 56, 57
3D-footprint Homologues: 2h27_A, 6jhe_A
Binding Motifs: 2h27_A CGGAmCy
Binding Sites: 2h27_B
2h27_C
Publications: Lane W.J, Darst S.A. The structural basis for promoter -35 element recognition by the group IV sigma factors. PLoS biology 4:e269 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.