Transcription Factor
Accessions: | 2h27_A (3D-footprint 20231221) |
Names: | ECF RNA polymerase sigma-E factor, RNA polymerase Sigma E factor, RPOE_ECOLI, Sigma-24 |
Organisms: | Escherichia coli, strain K12 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P0AGB6 |
Length: | 71 |
Pfam Domains: | 9-61 Sigma-70, region 4 15-64 ECF sigma factor 16-61 Sigma-70, region 4 |
Sequence: (in bold interface residues) | 1 SHMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRARE 60 61 AIDNKVQPLIR |
Interface Residues: | 37, 50, 52, 53, 56, 57 |
3D-footprint Homologues: | 2h27_A, 6jhe_A |
Binding Motifs: | 2h27_A CGGAmCy |
Binding Sites: | 2h27_B 2h27_C |
Publications: | Lane W.J, Darst S.A. The structural basis for promoter -35 element recognition by the group IV sigma factors. PLoS biology 4:e269 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.