Transcription Factor

Accessions: T027633_1.02 (CISBP 1.02), Q75HX9 (JASPAR 2024)
Names: LOC_Os05g36160, T027633_1.02;, Q75HX9_ORYSJ
Organisms: Oryza sativa, Oryza sativa Japonica Group
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:bZIP
Length: 247
Pfam Domains: 186-237 bZIP transcription factor
187-236 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 MASSRVMAAAAASSSSSPPPPPPAAAAAGGAADLARFRSTSSGIGSMNMDDILRNIYGEA 60
61 APPPGAAGSAPAPPPAGEAAGAPVAEVAARRTAEEVWKEISSSGGLSAPAPAPAAGAAGR 120
121 GGGPEMTLEDFLAREDDPRATAVEGNMVVGFPNVTEGVGTAGGGRGGGGGGRGRKRTLMD 180
181 PADRAAMQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQKRL 240
241 KEVSLIV
Interface Residues: 192, 195, 196, 197, 199, 200, 203, 204
3D-footprint Homologues: 7x5e_E, 2wt7_A, 8k86_A, 1gd2_G, 7x5e_F, 1dh3_C, 5t01_B, 5vpe_D, 2dgc_A
Binding Motifs: M0329_1.02 mCACGTGk
MA1033.1 mCACGTGk
MA2401.1 mCACGTGk
Publications: Izawa T., Foster R., Chua N.-H. Plant bZIP protein DNA binding specificity.. J. Mol. Biol. 230:1131-1144 (1993). [Pubmed]

O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.