Transcription Factor
| Accessions: | 1cqt_A (3D-footprint 20260701) |
| Names: | NF-A1, Oct-1, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P14859 |
| Length: | 134 |
| Pfam Domains: | 3-74 Pou domain - N-terminal to homeobox domain 75-131 Homeobox domain |
| Sequence: (in bold interface residues) | 1 EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMC 60 61 KLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRV 120 121 WFCNRRQKEKRINP |
| Interface Residues: | 26, 42, 43, 44, 45, 47, 48, 54, 58, 66, 75, 76, 77, 78, 82, 83, 86, 87, 116, 117, 119, 120, 123, 124, 126, 127, 128, 131 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 8bx1_A, 2xsd_C, 1o4x_A, 1e3o_C, 7xrc_C, 1au7_A, 8g87_X, 1lq1_D, 6a8r_A, 1ig7_A, 8ejp_B, 5zfz_A, 3cmy_A, 8pmf_A, 2r5y_A, 1puf_A, 1fjl_B, 1zq3_P, 1nk2_P, 2lkx_A, 6m3d_C, 7q3o_C, 6es3_K, 1b72_A, 8ik5_C, 4xrs_G, 3a01_E, 8eml_B, 2hdd_A, 5zjt_E, 5hod_A, 2hos_A, 5jlw_D, 2ld5_A, 8osb_E, 1le8_A, 4qtr_D, 3lnq_A, 1du0_A, 2d5v_B, 1jgg_B, 3rkq_B, 5flv_I, 4cyc_A, 7psx_B, 9b8u_A |
| Binding Motifs: | 1cqt_AI tATnCAAATA |
| Binding Sites: | 1cqt_M 1cqt_N |
| Publications: | Chasman D, Cepek K, Sharp P.A, Pabo C.O. Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface. Genes & development 13:2650-7 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.