Transcription Factor

Accessions: 1cqt_A (3D-footprint 20260701)
Names: NF-A1, Oct-1, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14859
Length: 134
Pfam Domains: 3-74 Pou domain - N-terminal to homeobox domain
75-131 Homeobox domain
Sequence:
(in bold interface residues)
1 EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMC 60
61 KLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRV 120
121 WFCNRRQKEKRINP
Interface Residues: 26, 42, 43, 44, 45, 47, 48, 54, 58, 66, 75, 76, 77, 78, 82, 83, 86, 87, 116, 117, 119, 120, 123, 124, 126, 127, 128, 131
3D-footprint Homologues: 7u0g_M, 3d1n_M, 8bx1_A, 2xsd_C, 1o4x_A, 1e3o_C, 7xrc_C, 1au7_A, 8g87_X, 1lq1_D, 6a8r_A, 1ig7_A, 8ejp_B, 5zfz_A, 3cmy_A, 8pmf_A, 2r5y_A, 1puf_A, 1fjl_B, 1zq3_P, 1nk2_P, 2lkx_A, 6m3d_C, 7q3o_C, 6es3_K, 1b72_A, 8ik5_C, 4xrs_G, 3a01_E, 8eml_B, 2hdd_A, 5zjt_E, 5hod_A, 2hos_A, 5jlw_D, 2ld5_A, 8osb_E, 1le8_A, 4qtr_D, 3lnq_A, 1du0_A, 2d5v_B, 1jgg_B, 3rkq_B, 5flv_I, 4cyc_A, 7psx_B, 9b8u_A
Binding Motifs: 1cqt_AI tATnCAAATA
Binding Sites: 1cqt_M
1cqt_N
Publications: Chasman D, Cepek K, Sharp P.A, Pabo C.O. Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface. Genes & development 13:2650-7 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.