Transcription Factor
| Accessions: | T012386_1.02 (CISBP 1.02), Q9CAA4 (JASPAR 2024), T00924 (AthalianaCistrome v4_May2016) |
| Names: | BIM2, T012386_1.02;, AtbHLH102, Basic helix-loop-helix protein 102, BES1-interacting Myc-like protein 2, bHLH 102, bHLH transcription factor bHLH102, BIM2_ARATH, Transcription factor BIM2, Transcription factor EN 125, AT1G69010, T00924; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | experiment type:PBM, family:bHLH, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq |
| Length: | 311 |
| Pfam Domains: | 47-96 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MRTGKGNQEEEDYGEEDFNSKREGPSSNTTVHSNRDSKENDKASAIRSKHSVTEQRRRSK 60 61 INERFQILRELIPNSEQKRDTASFLLEVIDYVQYLQEKVQKYEGSYPGWSQEPTKLTPWR 120 121 NNHWRVQSLGNHPVAINNGSGPGIPFPGKFEDNTVTSTPAIIAEPQIPIESDKARAITGI 180 181 SIESQPELDDKGLPPLQPILPMVQGEQANECPATSDGLGQSNDLVIEGGTISISSAYSHE 240 241 LLSSLTQALQNAGIDLSQAKLSVQIDLGKRANQGLTHEEPSSKNPLSYDTQGRDSSVEEE 300 301 SEHSHKRMKTL |
| Interface Residues: | 47, 49, 50, 51, 53, 54, 57, 58, 79, 282 |
| 3D-footprint Homologues: | 7z5k_B, 1an4_A, 4h10_B, 7ssa_L, 5nj8_D, 1am9_A, 7d8t_A, 5eyo_A, 5v0l_A, 7f2f_B, 5gnj_I, 6g1l_A, 4h10_A, 7rcu_E, 5i50_B, 8osl_P, 8osl_O, 6opm_B |
| Binding Motifs: | M0154_1.02 skCACGTGms MA0965.1 skCACGTGms M0156 rsmrsgtgwrwgkCACGTG M0157 CACGTGmcwykcacg MA0965.2 wwwgkCACGTGmcwww MA0965.3 CACGTG |
| Binding Sites: | MA0965.3.1 / MA0965.3.10 / MA0965.3.11 / MA0965.3.12 / MA0965.3.13 / MA0965.3.14 / MA0965.3.15 / MA0965.3.16 / MA0965.3.17 / MA0965.3.18 / MA0965.3.19 / MA0965.3.2 / MA0965.3.20 / MA0965.3.3 / MA0965.3.4 / MA0965.3.5 / MA0965.3.6 / MA0965.3.7 / MA0965.3.8 / MA0965.3.9 MA0965.1.1 MA0965.1.10 MA0965.1.11 MA0965.1.12 MA0965.1.13 MA0965.1.14 MA0965.1.15 MA0965.1.16 MA0965.1.17 MA0965.1.18 MA0965.1.19 MA0965.1.2 MA0965.1.20 MA0965.1.3 MA0965.1.4 MA0965.1.5 MA0965.1.6 MA0965.1.7 MA0965.1.8 MA0965.1.9 MA0965.2.1 MA0965.2.10 MA0965.2.11 MA0965.2.12 MA0965.2.13 MA0965.2.14 MA0965.2.15 MA0965.2.16 MA0965.2.17 MA0965.2.18 MA0965.2.19 MA0965.2.2 MA0965.2.20 MA0965.2.3 MA0965.2.4 MA0965.2.5 MA0965.2.6 MA0965.2.7 MA0965.2.8 MA0965.2.9 |
| Publications: | Yin Y, Vafeados D, Tao Y, Yoshida S, Asami T, Chory J. A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. Cell 120:249-59 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.