Transcription Factor

Accessions: RORB_TF1 (HumanTF2 1.0), RORB (HT-SELEX2 May2017)
Names: cDNA, FLJ93970, Homo sapiens RAR-related orphan receptor B (RORB, Q58EY0_HUMAN, RAR-related orphan receptor B, RAR-related orphan receptor beta, RORB, ENSG00000198963
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q58EY0
Notes: Ensembl ID: ENSG00000198963; Construct type: TF1(SBP); TF family: Nuclear_receptor; Clone source: Megaman, TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 99
Pfam Domains: 7-75 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 AQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRC 60
61 QHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQ
Interface Residues: 16, 17, 19, 20, 26, 27, 29, 30, 33, 34, 58, 80, 82
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A
Binding Motifs: RORB_1 AwgTrGGTyAGTRGGTCA
RORB_2 AwstRGGTCATGACCYaswT
RORB_3 dAwgTrGGTyAGTrGGTCAs
RORB_4 wAwstRGGTCRTGACCYaswTw
RORB_methyl_1 dAwgTrGGTyAGTRGGTCRc
RORB_methyl_2 wAwstRGGTCrTGACCYaswTw
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.