Transcription Factor

Accessions: 1am9_B (3D-footprint 20250804)
Names: bHLHd1, Class D basic helix-loop-helix protein 1, SRBP1_HUMAN, SREBP-1, STEROL REGULATORY ELEMENT BINDING PROTEIN 1A, Sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1, Transcription factor SREBF1
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P36956
Length: 75
Pfam Domains: 5-55 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 SRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQK 60
61 LKQENLSLRTAVHKS
Interface Residues: 6, 8, 9, 10, 12, 13, 16, 17, 38, 40, 73, 74, 75
3D-footprint Homologues: 2ypa_A, 7z5k_B, 1an4_A, 8ia3_B, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 8osl_O, 7f2f_B, 5eyo_A, 1am9_A, 5v0l_A, 4h10_A, 7rcu_E, 5i50_B, 8hov_A, 6g1l_A, 4h10_B, 7ssa_L, 8osl_P, 5nj8_C, 2yvh_A
Binding Motifs: 1am9_AB gTCaCcCCaC
Binding Sites: 1am9_G
1am9_F
Publications: Párraga A, Bellsolell L, Ferré-D'Amaré A.R, Burley S.K. Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution. Structure (London, England : 1993) 6:661-72 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.