Transcription Factor
| Accessions: | 1am9_B (3D-footprint 20250804) |
| Names: | bHLHd1, Class D basic helix-loop-helix protein 1, SRBP1_HUMAN, SREBP-1, STEROL REGULATORY ELEMENT BINDING PROTEIN 1A, Sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1, Transcription factor SREBF1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P36956 |
| Length: | 75 |
| Pfam Domains: | 5-55 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 SRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQK 60 61 LKQENLSLRTAVHKS |
| Interface Residues: | 6, 8, 9, 10, 12, 13, 16, 17, 38, 40, 73, 74, 75 |
| 3D-footprint Homologues: | 2ypa_A, 7z5k_B, 1an4_A, 8ia3_B, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 8osl_O, 7f2f_B, 5eyo_A, 1am9_A, 5v0l_A, 4h10_A, 7rcu_E, 5i50_B, 8hov_A, 6g1l_A, 4h10_B, 7ssa_L, 8osl_P, 5nj8_C, 2yvh_A |
| Binding Motifs: | 1am9_AB gTCaCcCCaC |
| Binding Sites: | 1am9_G 1am9_F |
| Publications: | Párraga A, Bellsolell L, Ferré-D'Amaré A.R, Burley S.K. Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution. Structure (London, England : 1993) 6:661-72 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.