Transcription Factor

Accessions: 1mnm_B (3D-footprint 20250804)
Names: GRM/PRTF protein, MCM1 TRANSCRIPTIONAL REGULATOR, MCM1_YEAST, Pheromone receptor transcription factor
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P11746
Length: 81
Pfam Domains: 7-57 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKF 60
61 EPIVTQQEGRNLIQACLNAPD
Interface Residues: 1, 2, 13, 16, 17, 21
3D-footprint Homologues: 1n6j_A, 8q9q_A, 1egw_B, 7xuz_H, 8q9r_F, 1hbx_A, 8q9n_B, 8q9p_B, 1c7u_A, 1mnm_A
Binding Motifs: 1mnm_ABCD ATTrCCTAnnnnGGAAATTTACAA
Publications: Tan S, Richmond T.J. Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex. Nature 391:660-6 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.