Transcription Factor

						

			
Accessions: 5wjq_D (3D-footprint 20231221)

			
Names: Zinc finger protein 568, ZN568_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 281
Pfam Domains:      5-17 C2H2-type zinc finger
     6-28 C2H2-type zinc finger
     6-28 Zinc finger, C2H2 type
    21-43 Zinc-finger double domain
    34-56 C2H2-type zinc finger
    34-45 C2H2-type zinc finger
    34-56 Zinc finger, C2H2 type
    48-72 Zinc-finger double domain
    61-72 C2H2-type zinc finger
    62-84 Zinc finger, C2H2 type
    62-84 C2H2-type zinc finger
   77-101 Zinc-finger double domain
   90-112 Zinc finger, C2H2 type
   90-112 C2H2-type zinc finger
   90-100 C2H2-type zinc finger
  107-127 Zinc-finger double domain
  117-127 C2H2-type zinc finger
  118-140 Zinc finger, C2H2 type
  118-140 C2H2-type zinc finger
  132-156 Zinc-finger double domain
  145-168 C2H2-type zinc finger
  146-168 Zinc finger, C2H2 type
  146-168 C2H2-type zinc finger
  161-185 Zinc-finger double domain
  173-196 C2H2-type zinc finger
  174-196 Zinc finger, C2H2 type
  174-196 C2H2-type zinc finger
  189-211 Zinc-finger double domain
  201-224 C2H2-type zinc finger
  202-224 C2H2-type zinc finger
  202-224 Zinc finger, C2H2 type
  217-240 Zinc-finger double domain
  229-250 C2H2-type zinc finger
  230-252 C2H2-type zinc finger
  230-252 Zinc finger, C2H2 type
  245-267 Zinc-finger double domain
  257-278 C2H2-type zinc finger
  258-280 C2H2-type zinc finger
  258-280 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 GSEKPYKCQECGKAFPSNAQLSLHHRVHTDEKCFECKECGKAFMRPSHLLRHQRIHTGEK   60
  61 PHKCKECGKAFRYDTQLSLHLLTHAGARRFECKDCDKVYSCASQLALHQMSHTGEKPHKC  120
 121 KECGKGFISDSHLLRHQSVHTGETPYKCKECGKGFRRGSELARHQRAHSGDKPYKCKECG  180
 181 KSFTCTTELFRHQKVHTGDRPHKCKECGKAFIRRSELTHHERSHSGEKPYECKECGKTFG  240
 241 RGSELSRHQKIHTGEKPYKCQQCGKAFIRGSHLTQHQRIHT
Interface Residues: 17, 20, 23, 27, 44, 45, 47, 48, 51, 72, 73, 74, 75, 76, 78, 79, 100, 101, 102, 103, 104, 107, 110, 128, 129, 131, 132, 134, 135, 137, 138, 141, 156, 157, 158, 159, 160, 163, 164, 167, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 197, 200, 212, 213, 214, 215, 216, 217, 218, 219, 225, 239, 240, 241, 242, 243, 244, 246, 247, 251, 268, 269, 270, 271, 272, 274, 275
3D-footprint Homologues: 8ssu_A, 8ssq_A, 8cuc_F, 3uk3_C, 5v3j_F, 5yj3_D, 7w1m_H, 5yel_A, 1tf3_A, 7ysf_A, 5und_A, 1tf6_A, 2i13_A, 5ei9_F, 6a57_A, 2jpa_A, 5kkq_D, 6wmi_A, 5k5i_A, 4m9v_C, 6e94_A, 6jnm_A, 2gli_A, 1g2f_F, 6ml4_A, 4x9j_A, 5kl3_A, 7eyi_G, 2lt7_A, 1ubd_C, 7n5w_A, 5k5l_F, 1llm_D, 6blw_A, 6u9q_A, 1mey_C, 7txc_E, 2kmk_A, 8h9h_G, 7y3m_I, 7y3l_A, 8gn3_A, 2wbs_A, 2drp_D, 1f2i_J
Binding Motifs: 5wjq_D TGGnCGTGGCaCrGGTaAnwAGGG
Binding Sites: 5wjq_A
5wjq_B
			
Publications: Patel A, Yang P, Tinkham M, Pradhan M, Sun MA, Wang Y, Hoang D, Wolf G, Horton JR, Zhang X, Macfarlan T, Cheng X. DNA Conformation Induces Adaptable Binding by Tandem Zinc Finger Proteins. Cell 173:221-233 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.