Transcription Factor
| Accessions: | 5lux_K (3D-footprint 20231221) |
| Names: | Caudal-type homeobox protein 1, CDX1_HUMAN, Homeobox protein CDX-1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P47902 |
| Length: | 63 |
| Pfam Domains: | 4-59 Homeobox domain |
| Sequence: (in bold interface residues) | 1 TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKV 60 61 NKK |
| Interface Residues: | 3, 4, 5, 6, 44, 45, 47, 48, 51, 52, 55, 56, 58, 59 |
| 3D-footprint Homologues: | 3d1n_M, 1jgg_B, 3lnq_A, 1nk2_P, 2ld5_A, 7q3o_C, 6es3_K, 5zfz_A, 1ig7_A, 4cyc_A, 2h1k_B, 5flv_I, 1puf_A, 5zjt_E, 3a01_E, 7psx_B, 1fjl_B, 2lkx_A, 6a8r_A, 1b72_A, 3cmy_A, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 7xrc_C, 2xsd_C, 1e3o_C, 1au7_A, 2h8r_B, 1ic8_B, 1le8_A, 1o4x_A, 1le8_B, 3l1p_A, 8g87_X, 4qtr_D, 1mnm_C, 5hod_A, 1puf_B, 1k61_B, 4xrm_B, 1zq3_P, 1du0_A, 6m3d_C |
| Binding Motifs: | 5lux_K tnnTAAa |
| Binding Sites: | 5lux_A 5lux_F |
| Publications: | Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.