Transcription Factor
| Accessions: | 4iht_C (3D-footprint 20260701) |
| Names: | Ben and cat operon transcriptional regulator, BENM_ACIAD, HTH-type transcriptional regulator BenM |
| Organisms: | Acinetobacter baylyi, strain ATCC 33305 / BD413 / ADP1 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O68014 |
| Length: | 86 |
| Pfam Domains: | 3-62 Bacterial regulatory helix-turn-helix protein, lysR family |
| Sequence: (in bold interface residues) | 1 MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPE 60 61 GHFFYQYAIKLLSNVDQMVSMTKRIA |
| Interface Residues: | 28, 29, 30, 31, 33, 34, 52, 53 |
| 3D-footprint Homologues: | 4iht_D, 5xxp_A, 7d98_Q |
| Binding Motifs: | 4iht_CD ATAcnnnnnnAGTaTT |
| Publications: | Alanazi AM, Neidle EL, Momany C. The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators. Acta Crystallogr D Biol Crystallogr : (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.