Transcription Factor

						

			
Accessions: 4iht_C (3D-footprint 20231221)

			
Names: Ben and cat operon transcriptional regulator, BENM_ACIAD, HTH-type transcriptional regulator BenM
Organisms: Acinetobacter baylyi, strain ATCC 33305 / BD413 / ADP1
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O68014
Length: 86
Pfam Domains:      3-62 Bacterial regulatory helix-turn-helix protein, lysR family
Sequence: 
(in bold interface residues)		   1 MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPE   60
  61 GHFFYQYAIKLLSNVDQMVSMTKRIA
Interface Residues: 28, 29, 30, 31, 33, 34, 52, 53
3D-footprint Homologues: 4iht_D, 5xxp_A, 7d98_Q
Binding Motifs: 4iht_CD ATAcnnnnnnAGTaTT
			
Publications: Alanazi AM, Neidle EL, Momany C. The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators. Acta Crystallogr D Biol Crystallogr : (2013). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.