Transcription Factor

						

			
Accessions: 3jtg_A (3D-footprint 20231221)

			
Names: E74-like factor 3, ELF3_MOUSE, Epithelial-restricted with serine box, Epithelium-restricted Ets protein ESX, Epithelium-specific Ets transcription factor 1, ESE-1, ETS-related transcription factor Elf-3
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q3UPW2
Length: 95
Pfam Domains:      2-85 Ets-domain
Sequence: 
(in bold interface residues)		   1 GTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSR   60
  61 AMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEV
Interface Residues: 56, 57, 59, 60, 61, 63, 64, 78
3D-footprint Homologues: 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4uno_A, 3jtg_A, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A, 4iri_A, 1bc8_C
Binding Motifs: 3jtg_A TTCCTgnTT
Binding Sites: 3jtg_B
3jtg_C
			
Publications: Agarkar V.B, Babayeva N.D, Wilder P.J, Rizzino A, Tahirov T.H. Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA. Journal of molecular biology 397:278-89 (2010). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.