Transcription Factor

						

			
Accessions: CG4854 (FlyZincFinger 1.0 )

			
Names: CG4854
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 137
Pfam Domains:      2-24 C2H2-type zinc finger
     2-25 C2H2-type zinc finger
     2-24 Zinc finger, C2H2 type
    17-40 Zinc-finger double domain
    29-52 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
    30-52 C2H2-type zinc finger
    45-68 Zinc-finger double domain
    57-68 C2H2-type zinc finger
    58-80 Zinc finger, C2H2 type
    58-80 C2H2-type zinc finger
    75-97 Zinc-finger double domain
   85-108 C2H2-type zinc finger
   86-108 Zinc finger, C2H2 type
   86-108 C2H2-type zinc finger
  101-124 Zinc-finger double domain
  114-124 C2H2-type zinc finger
  114-136 Zinc finger, C2H2 type
  114-136 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 SFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKC   60
  61 DYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQ  120
 121 KSFSQLHHKNSHEKSHK
Interface Residues: 12, 13, 15, 16, 19, 40, 41, 42, 43, 44, 46, 47, 49, 50, 53, 68, 69, 70, 71, 72, 75, 78, 79, 96, 97, 98, 99, 100, 101, 102, 103, 104, 125, 126, 127, 128, 129, 131, 132
3D-footprint Homologues: 1tf3_A, 1tf6_A, 8ssu_A, 5v3j_F, 5k5i_A, 7w1m_H, 7ysf_A, 8ssq_A, 7n5w_A, 2ky8_A, 6c1t_D, 5ei9_F, 2kmk_A, 7txc_E, 6blw_A, 6ml4_A, 2gli_A, 5kkq_D, 8h9h_G, 2lt7_A, 6e94_A, 5yel_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 6jnm_A, 6u9q_A, 5yj3_D, 4x9j_A, 1g2f_F, 5kl3_A, 1f2i_J, 6a57_A, 3uk3_C, 2wbs_A, 8gn3_A, 1llm_D, 2drp_D, 4m9v_C, 7y3m_I
Binding Motifs: CG4854_SANGER_10_FBgn0038766 GtgGTTGGCAAC
CG4854_SOLEXA_5_FBgn0038766 ayskrkkbvrkgtrGTTGGCAACrc
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.