Transcription Factor

Accessions: 1c0w_D (3D-footprint 20231221)
Names: DIPHTHERIA TOXIN REPRESSOR, DTXR_CORDI, Iron-dependent diphtheria tox regulatory element, Tox regulatory factor
Organisms: Corynebacterium diphtheriae, strain ATCC 700971 / NCTC 13129 / Biotype gravis
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0DJL7
Length: 175
Pfam Domains: 2-61 Iron dependent repressor, N-terminal DNA binding domain
64-133 Iron dependent repressor, metal binding and dimerisation domain
Sequence:
(in bold interface residues)
1 KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS 60
61 LQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLK 120
121 DVSRSPFGNPIPGLDELGVVQINEIFQVETDQFTQLLDADIRVVELLDDLAHTIR
Interface Residues: 36, 38, 39, 41, 42, 46
3D-footprint Homologues: 4lln_I, 1f5t_A, 7b24_C, 1u8r_B, 2isz_B, 1ddn_B
Binding Motifs: 1c0w_ABCD TnAGGTAGCCTACCT
Binding Sites: 1c0w_E
1c0w_F
Publications: Pohl E, Holmes R.K, Hol W.G. Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain. Journal of molecular biology 292:653-67 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.