Transcription Factor

Accessions: 5yi3_M (3D-footprint 20231221), 5yi3_N (3D-footprint 20231221)
Names: Q9CDU5_LACLA, Zinc transport transcriptional regulator
Organisms: Lactococcus lactis, Lactococcus lactis subsp. lactis (strain IL1403)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 144
Pfam Domains: 34-91 MarR family
34-89 MarR family
35-80 Winged helix-turn-helix DNA-binding
35-98 Winged helix DNA-binding domain
40-81 Bacterial regulatory protein, arsR family
40-83 Transcriptional regulator
41-80 Iron dependent repressor, N-terminal DNA binding domain
41-113 TFIIE alpha subunit
Sequence:
(in bold interface residues)
1 SLANQIDQFLGTIMQFAENKHEILLGKSESDVKLTSTQEHILMLLAEQISTNAKIAEKLK 60
61 ISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEKAVPVAKEHATHHEKTLSTYQEL 120
121 GNKFTDEEQEVISKFLSALTEEFQ
Interface Residues: 35, 37, 52, 62, 63, 64, 65, 67, 68, 69, 72, 89
3D-footprint Homologues: 4kdp_B, 7el3_B, 6c2s_C, 1z9c_A, 6jbx_A, 3q5f_A, 5yi2_J, 8c7s_A, 4aik_A, 5hlg_E, 3zpl_B
Binding Motifs: 5yi3_MN TTAACTnGTTaA
Binding Sites: 5yi3_O / 5yi3_P
Publications: Zhu R, Song Y, Liu H, Yang Y, Wang S, Yi C, Chen PR. Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. Proc Natl Acad Sci U S A 114:13661-13666 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.