Transcription Factor
Accessions: | 6l6l_A (3D-footprint 20231221), 6l6q_A (3D-footprint 20231221), 6l6q_B (3D-footprint 20231221) |
Names: | Immediate-early response protein NOT, NR4A2_HUMAN, Nuclear receptor related 1, Nuclear receptor subfamily 4 group A member 2, Orphan nuclear receptor NURR1, Transcriptionally-inducible nuclear receptor |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P43354 |
Length: | 85 |
Pfam Domains: | 1-69 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ 60 61 KCLAVGMVKEVVRTDSLKGRRGRLP |
Interface Residues: | 10, 11, 13, 14, 20, 21, 23, 24, 27, 28, 32, 33, 36, 52, 78, 81, 83 |
3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2a66_A, 8hbm_B, 5krb_G, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 4umm_E, 8cef_H, 2han_B, 1kb2_B, 5cbx_B, 5cbz_E, 4hn5_B, 4tnt_B, 5e69_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 4rul_A |
Binding Motifs: | 6l6l_A TGACCnA 6l6l_AB AGGnCAnnnnnTGACCnA 6l6q_AB TnACcTnTAnAGGTCA 6l6q_B TGACCTnnA |
Binding Sites: | 6l6l_C 6l6l_D 6l6q_C / 6l6q_F |
Publications: | Jiang L, Dai S, Li J, Liang X, Qu L, Chen X, Guo M, Chen Z, Chen L, Wei H, Chen Y. Structural basis of binding of homodimers of the nuclear receptor NR4A2 to selective Nur-responsive DNA elements. J Biol Chem 294:19795-19803 (2019). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.