Transcription Factor

Accessions: 5d5v_D (3D-footprint 20231221)
Names: Heat shock factor protein 1, Heat shock transcription factor 1, HSF 1, HSF1_HUMAN, HSTF 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q00613
Length: 107
Pfam Domains: 5-106 HSF-type DNA-binding
Sequence:
(in bold interface residues)
1 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQ 60
61 LNMYGFRKVVHIEQGGVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
Interface Residues: 50, 51, 56, 58, 59, 60, 62, 63, 104
3D-footprint Homologues: 5hdn_C, 5d5w_B, 3hts_B, 4bqa_A, 5d5v_B, 7dci_A
Binding Motifs: 5d5v_BD GGAnTGGA
Binding Sites: 5d5v_A
5d5v_C
Publications: Neudegger T, Verghese J, Hayer-Hartl M, Hartl FU, Bracher A. Structure of human heat-shock transcription factor 1 in complex with DNA. Nat Struct Mol Biol 23:140-6 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.